PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G49330.1
Common NameATMYB111, MYB111, PFG3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 342aa    MW: 38480.8 Da    PI: 4.9547
Description myb domain protein 111
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G49330.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.6e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWT+eEde+l ++++  G g+W++ +++ g+ R++k+c++rw +yl
      AT5G49330.1 14 RGRWTAEEDEILTKYIQTNGEGSWRSLPKKAGLLRCGKSCRLRWINYL 61
                     8*******************************99************97 PP

2Myb_DNA-binding55.31.5e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T +E+e++v+++ +lG++ W++Ia +++ gRt++++k++w+++l
      AT5G49330.1  67 RGNITSDEEEIIVKLHSLLGNR-WSLIATHLP-GRTDNEIKNYWNSHL 112
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.984961IPR017930Myb domain
SuperFamilySSF466893.67E-2811108IPR009057Homeodomain-like
SMARTSM007179.2E-131363IPR001005SANT/Myb domain
PfamPF002491.3E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-221568IPR009057Homeodomain-like
CDDcd001679.88E-91661No hitNo description
PROSITE profilePS5129426.67162116IPR017930Myb domain
SMARTSM007173.7E-1666114IPR001005SANT/Myb domain
PfamPF002495.2E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2469116IPR009057Homeodomain-like
CDDcd001672.06E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051555Biological Processflavonol biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGRAPCCEKI GLKRGRWTAE EDEILTKYIQ TNGEGSWRSL PKKAGLLRCG KSCRLRWINY  60
LRRDLKRGNI TSDEEEIIVK LHSLLGNRWS LIATHLPGRT DNEIKNYWNS HLSRKIYAFT  120
AVSGDGHNLL VNDVVLKKSC SSSSGAKNNN KTKKKKKGRT SRSSMKKHKQ MVTASQCFSQ  180
PKELESDFSE GGQNGNFEGE SLGPYEWLDG ELERLLSSCV WECTSEEAVI GVNDEKVCES  240
GDNSSCCVNL FEEEQGSETK IGHVGITEVD HDMTVERERE GSFLSSNSNE NNDKDWWVGL  300
CNSSEVGFGV DEELLDWEFQ GNVTCQSDDL WDLSDIGEIT LE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible248596_at0.0
Expression AtlasAT5G49330-
AtGenExpressAT5G49330-
ATTED-IIAT5G49330-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00598PBM24477691Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G49330.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G53230
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G49330
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3719770.0AF371977.1 Arabidopsis thaliana putative transcription factor (At5g49330) mRNA, complete cds.
GenBankAY5196340.0AY519634.1 Arabidopsis thaliana MYB transcription factor (At5g49330) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199744.10.0myb domain protein 111
SwissprotO222641e-76MYB12_ARATH; Transcription factor MYB12
TrEMBLQ9FJ070.0Q9FJ07_ARATH; MYB transcription factor
STRINGAT5G49330.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  4. Baudry A, et al.
    TT2, TT8, and TTG1 synergistically specify the expression of BANYULS and proanthocyanidin biosynthesis in Arabidopsis thaliana.
    Plant J., 2004. 39(3): p. 366-80
    [PMID:15255866]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Knight CA, et al.
    Expression profiling and local adaptation of Boechera holboellii populations for water use efficiency across a naturally occurring water stress gradient.
    Mol. Ecol., 2006. 15(5): p. 1229-37
    [PMID:16626450]
  7. Oravecz A, et al.
    CONSTITUTIVELY PHOTOMORPHOGENIC1 is required for the UV-B response in Arabidopsis.
    Plant Cell, 2006. 18(8): p. 1975-90
    [PMID:16829591]
  8. Bezhani S, et al.
    Unique, shared, and redundant roles for the Arabidopsis SWI/SNF chromatin remodeling ATPases BRAHMA and SPLAYED.
    Plant Cell, 2007. 19(2): p. 403-16
    [PMID:17293567]
  9. Stracke R, et al.
    Differential regulation of closely related R2R3-MYB transcription factors controls flavonol accumulation in different parts of the Arabidopsis thaliana seedling.
    Plant J., 2007. 50(4): p. 660-77
    [PMID:17419845]
  10. Kleine T,Kindgren P,Benedict C,Hendrickson L,Strand A
    Genome-wide gene expression analysis reveals a critical role for CRYPTOCHROME1 in the response of Arabidopsis to high irradiance.
    Plant Physiol., 2007. 144(3): p. 1391-406
    [PMID:17478635]
  11. Yonekura-Sakakibara K, et al.
    Comprehensive flavonol profiling and transcriptome coexpression analysis leading to decoding gene-metabolite correlations in Arabidopsis.
    Plant Cell, 2008. 20(8): p. 2160-76
    [PMID:18757557]
  12. Stracke R, et al.
    The Arabidopsis bZIP transcription factor HY5 regulates expression of the PFG1/MYB12 gene in response to light and ultraviolet-B radiation.
    Plant Cell Environ., 2010. 33(1): p. 88-103
    [PMID:19895401]
  13. Stracke R, et al.
    Analysis of PRODUCTION OF FLAVONOL GLYCOSIDES-dependent flavonol glycoside accumulation in Arabidopsis thaliana plants reveals MYB11-, MYB12- and MYB111-independent flavonol glycoside accumulation.
    New Phytol., 2010. 188(4): p. 985-1000
    [PMID:20731781]
  14. Li S,Zachgo S
    TCP3 interacts with R2R3-MYB proteins, promotes flavonoid biosynthesis and negatively regulates the auxin response in Arabidopsis thaliana.
    Plant J., 2013. 76(6): p. 901-13
    [PMID:24118612]